| Name | EXPH5, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302161 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL |
| Purity/Format | Affinity purified |
| Description | EXPH5 antibody |
| Gene | EXPH5 |
| Supplier Page | Shop |