BCAT1 antibody

Name BCAT1 antibody
Supplier Acris Antibodies
Catalog TA339286
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
Antigen The immunogen for anti-Bcat1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Bcat1
Supplier Page Shop

Product images