FOXQ1 antibody
| Name | FOXQ1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341770 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-Foxq1 antibody: synthetic peptide directed towards the middle region of mouse Foxq1. Synthetic peptide located within the following region: ADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARS. |
| Description | Rabbit Polyclonal |
| Gene | Foxq1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Foxq1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Brain