FSBP antibody

Name FSBP antibody
Supplier Acris Antibodies
Catalog TA331162
Prices $325.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-FSBP antibody: synthetic peptide directed towards the N terminal of human FSBP. Synthetic peptide located within the following region: KEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQS.
Description Rabbit Polyclonal
Gene FSBP
Supplier Page Shop

Product images