FSBP antibody
| Name | FSBP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341583 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Rabbit, Rat |
| Antigen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN. |
| Description | Rabbit Polyclonal |
| Gene | FSBP |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RAD54B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysateRAD54B is supported by BioGPS gene expression data to be expressed in Jurkat