KCNJ1 antibody
| Name | KCNJ1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA328922 |
| Prices | $435.00 |
| Sizes | 200 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1, (MW: 33 kDa). Intracellular, C-terminus. |
| Purity/Format | The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then the antibody was affinity purified on immobilized Kir1.1-GST. |
| Description | Rabbit Polyclonal |
| Gene | Kcnj1 |
| Supplier Page | Shop |
Product images
Western blot analysis of rat kidney membranes: 1. Anti-Kir1.1 (ROMK1) antibody , (1:200). 2. Anti-Kir1.1 (ROMK1) antibody, preincubated with the control antigen.