KCNJ11 antibody
| Name | KCNJ11 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | 73-393 |
| Prices | $320.00 |
| Sizes | 5 ml |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | N363/71 |
| Applications | ICC/IF WB |
| Species Reactivities | Mouse, Rat |
| Antigen | Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISP DSLS, cytoplasmic C-terminus) of rat Kir6.2 (also known as ATP-sensitive inward rectifier potassium channel 11, Potassium channel inwardly rectifying subfamily J member 11, IKATP, Kcnj11 and BIR, accession number P70673). Mouse: 100% identity (46/46 amino acids identical). Human: 89% identity (41/46 amino acids identical). <50% identity with Kir6.1. |
| Description | Mouse Monoclonal |
| Gene | Kcnj11 |
| Supplier Page | Shop |
Product images
Immunoblot against extracts of COS cells transiently transfected with Myc-tagged Kir6.1, HA-tagged Kir6.2 or untagged Kv2.1 plasmid probed with N363/71 (left) or N52A/42 (right) TC supe.