SAMD1 / Atherin antibody
| Name | SAMD1 / Atherin antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331667 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-SAMD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SAMD1. Synthetic peptide located within the following region: GKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAF. |
| Description | Rabbit Polyclonal |
| Gene | SAMD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SAMD1; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml