SPINK9 antibody
| Name | SPINK9 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334385 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-SPINK9 antibody is: synthetic peptide directed towards the middle region of Human SPINK9. Synthetic peptide located within the following region: KKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGK. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SPINK9 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SPINK9; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml