SREBF1 / SREBP1 antibody
| Name | SREBF1 / SREBP1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342292 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of mouse SREBF1. Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL. |
| Description | Rabbit Polyclonal |
| Gene | Srebf1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate