TOR4A antibody
| Name | TOR4A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331887 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rat |
| Antigen | The immunogen for Anti-TOR4A Antibody is: synthetic peptide directed towards the C-terminal region of Human TOR4A. Synthetic peptide located within the following region: QYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMP. |
| Description | Rabbit Polyclonal |
| Gene | TOR4A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TOR4A; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/mlTOR4A is supported by BioGPS gene expression data to be expressed in HepG2