Anti-Cytokeratin 1 Picoband™ Antibody PB9656

• Supplier: Boster Bio
• Catalog: PB9656
• Prices: $240.00
• Sizes: 1
• Host: Rabbit
• Clonality: Polyclonal
• Applications: IHC-P WB
• Antigen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids.
• Purity/Format: Immunogen affinity purified.
• Description: Rabbit Polyclonal
• Gene: Krt1

Product References

Effect of interleukin-1beta and lipoxin A4 in human endometriotic stromal cells: - Effect of interleukin-1beta and lipoxin A4 in human endometriotic stromal cells:

Wu RF, Yang HM, Zhou WD, Zhang LR, Bai JB, Lin DC, Ng TW, Dai SJ, Chen QH, Chen QX. J Obstet Gynaecol Res. 2017 Feb;43(2):308-319.

Bovine recombinant lipopolysaccharide binding protein (BRLBP) regulated apoptosis - Bovine recombinant lipopolysaccharide binding protein (BRLBP) regulated apoptosis

Sun Y, Li L, Wu J, Yu P, Li C, Tang J, Li X, Huang S, Wang G. Mol Immunol. 2015 Jun;65(2):205-14.

Nanog and beta-catenin: a new convergence point in EpSC proliferation and - Nanog and beta-catenin: a new convergence point in EpSC proliferation and

Yin D, Tian L, Ye Y, Li K, Wang J, Cheng P, Chen A, Guo F, Huang H. Int J Mol Med. 2012 Apr;29(4):587-92.