| Name | Anti-MMP-12 Antibody RP1089 |
|---|---|
| Supplier | Boster Bio |
| Catalog | RP1089 |
| Prices | $200.00 |
| Sizes | 1 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ELISA WB |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Description | Rabbit Polyclonal |
| Gene | Mmp12 |
| Supplier Page | Shop |