CD35 Antibody
| Name | CD35 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13870 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFH NGTVVTYQCHTGPDGEQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CD35 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4668_CD35%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13870-img0003.jpg)
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells.