| Name | Anti-Cytokeratin 1 Antibody |
|---|---|
| Supplier | ARP American Research Products |
| Catalog | 10-P9656 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids. |
| Purity/Format | Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Description | Rabbit Polyclonal |
| Gene | Krt1 |
| Supplier Page | Shop |