Anti-Cytokeratin 1 Antibody

Name Anti-Cytokeratin 1 Antibody
Supplier ARP American Research Products
Catalog 10-P9656
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB IHC-P
Species Reactivities Human, Mouse, Rat
Antigen A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids.
Purity/Format Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Description Rabbit Polyclonal
Gene Krt1
Supplier Page Shop