| Name | Anti-MMP12 Antibody |
|---|---|
| Supplier | ARP American Research Products |
| Catalog | 10-R1089 |
| Prices | $269.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ELISA |
| Species Reactivities | Mouse |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids. |
| Purity/Format | Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
| Description | Rabbit Polyclonal |
| Gene | Mmp12 |
| Supplier Page | Shop |