Mmp-12 Antibody (R32074)
| Name | Mmp-12 Antibody (R32074) |
|---|---|
| Supplier | NSJ Bioreagent |
| Catalog | R32074 |
| Prices | $299.00 |
| Sizes | 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water) |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Applications | WB ELISA |
| Species Reactivities | Mouse |
| Antigen | Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody. |
| Purity/Format | Antigen affinity |
| Description | Rabbit Polyclonal |
| Gene | Mmp12 |
| Supplier Page | Shop |