Intrinsic factor antibody
| Name | Intrinsic factor antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346737 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-Gif antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gif. Synthetic peptide located within the following region: LIVSSINNIAENVNHKTYWEFLSGKTPLDEGVAYYIPFNHEHITANFTQY. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Gif |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Gif; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml