| Name | Lipoyltransferase 1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346780 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-LIPT1 antibody: synthetic peptide directed towards the N terminal of human LIPT1. Synthetic peptide located within the following region: NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LIPT1 |
| Supplier Page | Shop |