Anti-EXPH5 (internal region) polyclonal antibody

Name Anti-EXPH5 (internal region) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL1406
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within internal amino acids 1907-1956 (QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQV PEDGLSPSEPL) of Human EXPH5.
Description Rabbit Polyclonal
Gene EXPH5
Conjugate Unconjugated
Supplier Page Shop