beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody
| Name | beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58906 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV |
| Purity/Format | Affinity purified |
| Blocking Peptide | beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | B4GALT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP2-58906] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1638_beta-1-4-Galactosyltransferase%25202-B4GalT2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58906-img0001.jpg)
Immunocytochemistry/Immunofluorescence: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP2-58906] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.