| Name | MMP12, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS178278 |
| Prices | $245.00 |
| Sizes | 100 µg |
| Clonality | Polyclonal |
| Applications | WB ELISA |
| Species Reactivities | Mouse |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids. |
| Purity/Format | Immunogen Affinity Purified |
| Description | Anti-MMP12 Antibody |
| Gene | Mmp12 |
| Supplier Page | Shop |