Anti-Galactosidase-alpha-Picoband-trade-Antibody

• Supplier: Abgent, a WuXi AppTec company
• Catalog: ABO10155
• Prices: $240.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Mouse
• Antigen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.
• Purity/Format: Lyophilized
• Description: Rabbit Polyclonal
• Gene: Gla