gamma Sarcoglycan Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59744
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-F
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: SGCG
• Conjugate: Unconjugated

Product images

Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.

Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.

Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.