beta-1 Adrenergic R/ADRB1 Antibody

Name beta-1 Adrenergic R/ADRB1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59007
Prices $329.00
Sizes 50 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADRB1
Conjugate Unconjugated
Supplier Page Shop

Product images