Wnt-7b Antibody
| Name | Wnt-7b Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59564 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-F IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to WNT7B(wingless-type MMTV integration site family, member 7B) The peptide sequence was selected from the middle region of WNT7B (NP_478679) Peptide sequence WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WNT7B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Wnt-7b Antibody [NBP1-59564] - Titration: 0.2-1 ug/ml, Positive Control: Human kidney.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25719_Wnt-7b-Antibody-Western-Blot-NBP1-59564-img0007.jpg)
![Immunohistochemistry-Paraffin: Wnt-7b Antibody [NBP1-59564] - Human Brain, cortex tissue at an antibody concentration of 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25720_Wnt-7b-Antibody-Immunohistochemistry-Paraffin-NBP1-59564-img0006.jpg)