LIS1 Antibody
| Name | LIS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87769 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LIS1 Protein |
| Description | Rabbit Polyclonal |
| Gene | PAFAH1B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LIS1 Antibody [NBP1-87769] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5079_LIS1-Antibody-Western-Blot-NBP1-87769-img0005.jpg)
Western Blot: LIS1 Antibody [NBP1-87769] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5080_LIS1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87769-img0009.jpg)
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
![Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5081_LIS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87769-img0002.jpg)
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
![Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5082_LIS1-Antibody-Western-Blot-NBP1-87769-img0006.jpg)
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image from verified customer review.
![Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5083_LIS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87769-img0007.jpg)
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image from verified customer review.