Dopa Decarboxylase/DDC Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56918
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DDC(dopa decarboxylase (aromatic L-amino acid decarboxylase)) The peptide sequence was selected from the N terminal of DDC (NP_000781). Peptide sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE.
• Purity/Format: Protein A purified
• Blocking Peptide: Dopa Decarboxylase/DDC Blocking Peptide
• Description: Rabbit Polyclonal
• Gene: DDC
• Conjugate: Unconjugated