ELAVL4 Antibody (6B9)

• Supplier: Novus Biologicals
• Catalog: H00001996-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 6B9
• Applications: WB ELISA IHC-P Gene Silencing
• Species Reactivities: Human, Rat
• Antigen: ELAVL4 (NP_068771 312 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: ELAVL4
• Conjugate: Unconjugated

Product images

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9 Analysis of ELAVL4 expression in IMR-32.

Immunohistochemistry-Paraffin: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.2 ug/ml.

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # H00001996-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - ELAVL4 monoclonal antibody (M01), clone 6B9. Analysis of ELAVL4 expression in PC-12.

Western Blot: ELAVL4 Antibody (6B9) [H00001996-M01] - Analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.Lane 1: ELAVL4 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: ELAVL4 Antibody (6B9) [H00001996-M01] - Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.