PDIA6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57999
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the N terminal of PDIA6. Peptide sequence KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PDIA6
• Conjugate: Unconjugated

Product images

Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type : Mouse Brain lysate

Immunocytochemistry/Immunofluorescence: PDIA6 Antibody [NBP1-57999] - NT2 cells Red: Antibody Blue: DAPI Primary Dilution: 1ug/50ul antibody Secondary Antibody: Alexa goat anti-rabbit 594 Image Submitted by: Yuzhi Chen, University of Arkansas for Medical Sciences

Western Blot: PDIA6 Antibody [NBP1-57999] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml

Western Blot: PDIA6 Antibody [NBP1-57999] - Titration: 2 ug/ml Positive Control: Human NT2 cell lysate

Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type: 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000

Western Blot: PDIA6 Antibody [NBP1-57999] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml