CENPN Antibody

Name CENPN Antibody
Supplier Novus Biologicals
Catalog NBP1-79664
Prices $139.00, $369.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CENPN
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.