ACAA1 Antibody

Name ACAA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55156
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACAA1
Conjugate Unconjugated
Supplier Page Shop

Product images