Wnt-2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-83103
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNL
• Description: Rabbit Polyclonal
• Gene: WNT2

Product images

Western Blot: WNT2 Antibody [NBP1-83103] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: WNT2 Antibody [NBP1-83103] - Staining of human rectum shows strong positivity in glandular cells.

Product References

Activation of the Wnt pathway through Wnt2 promotes metastasis in pancreatic - Activation of the Wnt pathway through Wnt2 promotes metastasis in pancreatic

Jiang H, Li Q, He C, Li F, Sheng H, Shen X, Zhang X, Zhu S, Chen H, Chen X, Yang C, Gao H. Am J Cancer Res. 2014 Sep 6;4(5):537-44. eCollection 2014.