IDH3G Antibody
| Name | IDH3G Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85824 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IDH3G Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IDH3G |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IDH3G Antibody [NBP1-85824] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21585_IDH3G-Antibody-Western-Blot-NBP1-85824-img0004.jpg)
Western Blot: IDH3G Antibody [NBP1-85824] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
![Immunocytochemistry/Immunofluorescence: IDH3G Antibody [NBP1-85824] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21586_IDH3G%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85824-img0005.jpg)
Immunocytochemistry/Immunofluorescence: IDH3G Antibody [NBP1-85824] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824] - Staining of human cerebellum shows granular cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21587_IDH3G-Antibody-Immunohistochemistry-Paraffin-NBP1-85824-img0001.jpg)
Immunohistochemistry-Paraffin: IDH3G Antibody [NBP1-85824] - Staining of human cerebellum shows granular cytoplasmic positivity in Purkinje cells.
![Western Blot: IDH3G Antibody [NBP1-85824] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21588_IDH3G-Antibody-Western-Blot-NBP1-85824-img0002.jpg)
Western Blot: IDH3G Antibody [NBP1-85824] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue