SNX17 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-92417
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SNX17 Protein
• Description: Rabbit Polyclonal
• Gene: SNX17
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: SNX17 Antibody [NBP1-92417] - Staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human placenta shows moderate cytoplasmic positivity.

Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SNX17 Antibody [NBP1-92417] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.