| Name | IDH3A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54736 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IDH3A(isocitrate dehydrogenase 3 (NAD+) alpha) The peptide sequence was selected from the N terminal of IDH3A. Peptide sequence MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | IDH3A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |