ASTN2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59195
• Prices: $369.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF
• Species Reactivities: Human, Mouse, Pig, Guinea Pig, Rabbit
• Antigen: Synthetic peptides corresponding to ASTN2(astrotactin 2) The peptide sequence was selected from the N terminal of ASTN2. Peptide sequence PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS.
• Purity/Format: Peptide affinity purified
• Description: Rabbit Polyclonal
• Gene: ASTN2

Product images

Western Blot: ASTN2 Antibody [NBP1-59195] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Immunocytochemistry/Immunofluorescence: ASTN2 Antibody [NBP1-59195] - Human Fibroblasts at a 1:100 dilution.

Western Blot: ASTN2 Antibody [NBP1-59195] - MCF7 tissue lysate at a concentration of 1ug/ml.

Immunocytochemistry/Immunofluorescence: ASTN2 Antibody [NBP1-59195] - Mouse Cerebellar Granule Cells at a 1:100 dilution.