ADAMTS9 Antibody
| Name | ADAMTS9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82916 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ADAMTS9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADAMTS9 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ADAMTS9 Antibody [NBP1-82916] - Staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2632_ADAMTS9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82916-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ADAMTS9 Antibody [NBP1-82916] - Staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & centrosome.
![Immunohistochemistry-Paraffin: ADAMTS9 Antibody [NBP1-82916] - Staining of human kidney shows moderate cytoplasmic positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2633_ADAMTS9-Antibody-Immunohistochemistry-Paraffin-NBP1-82916-img0005.jpg)
Immunohistochemistry-Paraffin: ADAMTS9 Antibody [NBP1-82916] - Staining of human kidney shows moderate cytoplasmic positivity in tubular cells.