EIF1AY Antibody
| Name | EIF1AY Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85808 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EIF1AY Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EIF1AY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16893_EIF1AY-Antibody-Western-Blot-NBP1-85808-img0008.jpg)
Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
![Immunocytochemistry/Immunofluorescence: EIF1AY Antibody [NBP1-85808] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16894_EIF1AY-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85808-img0003.jpg)
Immunocytochemistry/Immunofluorescence: EIF1AY Antibody [NBP1-85808] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: EIF1AY Antibody [NBP1-85808] - Staining of human prostate shows strong nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16895_EIF1AY-Antibody-Immunohistochemistry-Paraffin-NBP1-85808-img0006.jpg)
Immunohistochemistry-Paraffin: EIF1AY Antibody [NBP1-85808] - Staining of human prostate shows strong nuclear and cytoplasmic positivity in glandular cells.
![Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16896_EIF1AY-Antibody-Western-Blot-NBP1-85808-img0005.jpg)
Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16897_EIF1AY%2520Antibody-Western%2520Blot-NBP1-85808-img0007.jpg)
Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).