RGS6 Antibody
| Name | RGS6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58897 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RGS6 (regulator of G-protein signalling 6) The peptide sequence was selected from the C terminal of RGS6. Peptide sequence SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RGS6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RGS6 Antibody [NBP1-58897] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14317_RGS6-Antibody-Western-Blot-NBP1-58897-img0001.jpg)
Western Blot: RGS6 Antibody [NBP1-58897] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: RGS6 Antibody [NBP1-58897] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14318_RGS6-Antibody-Immunohistochemistry-Paraffin-NBP1-58897-img0002.jpg)
Immunohistochemistry-Paraffin: RGS6 Antibody [NBP1-58897] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Immunohistochemistry: RGS6 Antibody [NBP1-58897] - Human Pineal Tissue Observed Staining: Cytoplasm and Membrane of Human Pineal Tissue Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnifica](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14319_RGS6%2520Antibody-Immunohistochemistry-NBP1-58897-img0003.jpg)
Immunohistochemistry: RGS6 Antibody [NBP1-58897] - Human Pineal Tissue Observed Staining: Cytoplasm and Membrane of Human Pineal Tissue Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnifica