Alanyl tRNA synthetase Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57136
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: AARS
• Conjugate: Unconjugated

Product images

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell processes of pinealocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.