MOV10 Antibody
| Name | MOV10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57108 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MOV10(Mov10, Moloney leukemia virus 10, homolog (mouse)) The peptide sequence was selected from the C terminal of MOV10. Peptide sequence AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MOV10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MOV10 Antibody [NBP1-57108] - Transfected 293T, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14279_MOV10%2520Antibody-Western%2520Blot-NBP1-57108-img0001.jpg)
Western Blot: MOV10 Antibody [NBP1-57108] - Transfected 293T, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: MOV10 Antibody [NBP1-57108] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14280_MOV10%2520Antibody-Immunohistochemistry-Paraffin-NBP1-57108-img0002.jpg)
Immunohistochemistry-Paraffin: MOV10 Antibody [NBP1-57108] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.