RPE Antibody

Name RPE Antibody
Supplier Novus Biologicals
Catalog NBP1-56853
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPE(ribulose-5-phosphate-3-epimerase) The peptide sequence was selected from the middle region of RPE. Peptide sequence MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPE
Conjugate Unconjugated
Supplier Page Shop

Product images