FADS1 Antibody

Name FADS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-60085
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to FADS1(fatty acid desaturase 1) The peptide sequence was selected from the C terminal of FADS1. Peptide sequence FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene FADS1
Conjugate Unconjugated
Supplier Page Shop

Product images