PDIA6 Antibody
| Name | PDIA6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57968 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the middle region of PDIA6. Peptide sequence KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PDIA6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PDIA6 Antibody [NBP1-57968] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25694_PDIA6-Antibody-Western-Blot-NBP1-57968-img0008.jpg)
Western Blot: PDIA6 Antibody [NBP1-57968] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
![Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP1-57968] - Human small intestine tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25695_PDIA6-Antibody-Immunohistochemistry-Paraffin-NBP1-57968-img0004.jpg)
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP1-57968] - Human small intestine tissue.
![Western Blot: PDIA6 Antibody [NBP1-57968] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25696_PDIA6-Antibody-Western-Blot-NBP1-57968-img0002.jpg)
Western Blot: PDIA6 Antibody [NBP1-57968] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
![Western Blot: PDIA6 Antibody [NBP1-57968] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25697_PDIA6-Antibody-Western-Blot-NBP1-57968-img0005.jpg)
Western Blot: PDIA6 Antibody [NBP1-57968] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
![Western Blot: PDIA6 Antibody [NBP1-57968] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25698_PDIA6-Antibody-Western-Blot-NBP1-57968-img0006.jpg)
Western Blot: PDIA6 Antibody [NBP1-57968] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
![Western Blot: PDIA6 Antibody [NBP1-57968] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25699_PDIA6-Antibody-Western-Blot-NBP1-57968-img0007.jpg)
Western Blot: PDIA6 Antibody [NBP1-57968] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
![Western Blot: PDIA6 Antibody [NBP1-57968] - MCF7, Antibody Dilution: 1.0 ug/ml PDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25700_PDIA6%2520Antibody-Western%2520Blot-NBP1-57968-img0009.jpg)
Western Blot: PDIA6 Antibody [NBP1-57968] - MCF7, Antibody Dilution: 1.0 ug/ml PDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7.