RFC5 Antibody
| Name | RFC5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58108 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RFC5(replication factor C (activator 1) 5, 36.5kDa) The peptide sequence was selected from the N terminal of RFC5. Peptide sequence METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RFC5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RFC5 Antibody [NBP1-58108] - Jurkat cell lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24359_RFC5-Antibody-Western-Blot-NBP1-58108-img0001.jpg)
![Immunohistochemistry-Paraffin: RFC5 Antibody [NBP1-58108] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24360_RFC5-Antibody-Immunohistochemistry-Paraffin-NBP1-58108-img0002.jpg)