Alpha Actinin 3 Antibody

Name Alpha Actinin 3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55292
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTN3(actinin, alpha 3) The peptide sequence was selected from the N terminal of ACTN3. Peptide sequence VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTN3
Conjugate Unconjugated
Supplier Page Shop

Product images