PSAT1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55368
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PSAT1(phosphoserine aminotransferase 1) The peptide sequence was selected from the N terminal of PSAT1. Peptide sequence ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PSAT1
• Conjugate: Unconjugated

Product images

Western Blot: PSAT1 Antibody [NBP1-55368] - Sample Tissue: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-55368] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: PSAT1 Antibody [NBP1-55368] - Reccomended Titration: 1 ug/ml Positive Control: HepG2 cell lysate PSAT1 is supported by BioGPS gene expression data to be expressed in HepG2