Abhd5 Antibody
| Name | Abhd5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55457 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ABHD5 (NP_057090). Peptide sequence SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ABHD5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Abhd5 Antibody [NBP1-55457] - MCF7 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24124_Abhd5-Antibody-Western-Blot-NBP1-55457-img0002.jpg)
![Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-55457] - Human Colon Tissue, antibody concentration 10ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24125_Abhd5-Antibody-Immunohistochemistry-Paraffin-NBP1-55457-img0001.jpg)