Dyrk1B Antibody
| Name | Dyrk1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82643 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Dyrk1B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DYRK1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dyrk1B Antibody [NBP1-82643] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24865_Dyrk1B-Antibody-Western-Blot-NBP1-82643-img0006.jpg)
Western Blot: Dyrk1B Antibody [NBP1-82643] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: Dyrk1B Antibody [NBP1-82643] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24866_Dyrk1B-Antibody-Immunohistochemistry-NBP1-82643-img0008.jpg)
Immunohistochemistry: Dyrk1B Antibody [NBP1-82643] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.